PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0116s0044.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 350aa    MW: 38846.9 Da    PI: 7.3641
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0116s0044.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.11.5e-31148201255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH++F++av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Kalax.0116s0044.1.p 148 PRMRWTTTLHAHFIHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 201
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.23E-15145202IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-27146202IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-23148201IPR006447Myb domain, plants
PfamPF002491.7E-7149200IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MATSASSTPP LFIPDLSLQI SQPLFSNIMS SKNDSLGIMS SGAGVATEES GSSTGSGLSH  60
ETMNGGGFQQ AEHQPTLSLG LFDHHNLLHQ QQLLLLHHNN AIFAAKSEAA ARYHQNTHHH  120
HYSPQIYGRE YKVRSSSSRT MKRSIRAPRM RWTTTLHAHF IHAVQLLGGH ERATPKSVLE  180
LMNVKDLTLA HVKSHLQMYR TVKSTDKRSG QGRNDSDLDL NANNQRAEDI ADQVNGELPS  240
PQQNAQHWGP WGSAIETSDQ QTLSTHKEAS THQPNMSHRN HRKVYDDVGV GHLVNDERKE  300
QGLECSFLST YSDNSTTTLP PQQHQGLLNL EFTLGRPSWE LERQHSAGY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.11e-54G2-like family protein